LL-37 is a natural antimicrobial peptide produced by the human immune system to fight bacteria, viruses, and fungi. It works by disrupting the membranes of harmful microbes while promoting wound healing and modulating inflammation. Research shows it offers strong broad-spectrum protection and supports tissue repair in various studies.
Minimum order quantity: one box (10 vials x 5 mg).
Note: Product images show branded labels for illustration purposes only. All peptides are shipped in wholesale, unbranded packaging. You can see an actual example photo of the peptide vials and container above.
LL-37 5 mg – 10 Vial Box (50mg Total)
$333.0
Cost per vial $: 33.3
Buy LL-37 5 mg (one 10-vial box). All orders are shipped wholesale in unbranded packaging. Worldwide 7 – 14 day shipping to the USA, UK, AUS & NZ.
Description
Minimum order quantity: one box (10 vials x 5 mg).
Note: Product images show branded labels for illustration purposes only. All peptides are shipped in wholesale, unbranded packaging. You can see an actual example photo of the peptide vials and container above.
Additional information
≥99.0%
4493.34 g/mol
C₂₀₅H₃₄₀N₆₀O₅₃
[LL-37, 37 aa]
33.3
Related products
Thymosin Alpha-1 10mg – 10 Vial Box (100mg Total)
$500.0 Add to cartEpitalon 10 mg – 10 Vial Box (100mg Total)
$190.0 Add to cartEpitalon 50 mg – 10 Vial Box (500mg Total)
$490.0 Add to cart